Smifffy • 1 year ago

Absolutely loving the smell of the shower and bathroom cleaner sprays, they leave my bathroom not only sparkling clean but smelling super fresh too! I've been handing my vouchers out to work colleagues, neighbours, friends and family so hopefully they'll be equally impressed!

Locket • 1 year ago

Loving the smell of flash wipe done
Came home from work this afternoon and I could still smell it, it's amazing 👏

Cas58 • 1 year ago

The kitchen cleaner leaves the worktops and appliances sparkling clean and smelling lovely. I am very impressed with it. Can’t wait to try the bathroom cleaner.

PatchMW • 1 year ago

Really impressed with Flash Kitchen Cleaning Spray! It makes cleaning up so much easier—cuts through grease effortlessly and leaves my surfaces sparkling. Scent is subtle too.

arthie777 • 1 year ago

Absolutely loving these new Flash cleaning sprays. The bathroom smells super and sparkling clean and also the kitchen spray has a lovely fragrance and makes me feel that spring is in the air. Looking forward to handing out the money off vouchers to family and friends so they can try these lovely sprays out too.

Jo2ndhandrose • 1 year ago

Loving the ease of use of the Kitchen and Bathroom Spray Wipe Done bottles. They both clean effectively and smear free with a great fragrance

MaMeli • 1 year ago

Absolutely love the Kitchen and Bathroom sprays. I did struggle to get the nozzle turned on the bathroom spray but once rotated a few times, it loosened ok.
Love the smells. I find if I spray and don't wipe immediately the smell has a bit more of a chance to linger in the air. Absolutely love both products and will be off this weekend to get the shower spray. Well done Flash!

SammyKaz • 1 year ago

Absolutely over the moon with my flash spray bathroom and shower spray. I love the fact that it actually does what it says on the bottle. You spray and literally wipe and your left with beautiful, sparkling surfaces. The scent lasts for a good couple of days too!!!

100yoga • 1 year ago

Delighted to be part of the Flash team and trialing their Spray, Wipe, Done products. Highly recommend, does exactly what it says on the bottle and smells great too.

Lottylil • 1 year ago

Love the bathroomand shower sprays gets rid of stains and smellslovely

Sanawil1 • 1 year ago

Wow just wow the kitchen spray smells lovely the bathroom is unreal Thankyou for choosing me x

Sammi19 • 1 year ago

I am loving mine! Went and stocked up today and got some more 🩷🧡

BargainDevon • 1 year ago

I just want to say how amazing these flash sprays are, not onky do the actually clean well but makes my kitchen and bathroom smell lush!

FiJayB • 1 year ago

Loving the smell, it lasts all day in the bathroom. Very impressed and sharing the vouchers with friends so they can be too

Jovybon66 • 1 year ago

Absolutely love using Spray Flash Done Kitchen, the Bright mandarin fragrance is so fresh and leaves a lovely smell in the Kitchen. It cleans effortlessly too and literally it is all you have to do is Spray Wipe Done it’s that simple.

Miak • 1 year ago

Loved using both of theses its left both my bathroom and show sparkling clean and smelling fresh.
just spray and wipe down.
My friends loveth the vouchers.

charol • 1 year ago

Well , these Flash liquids have proved a wonderful solution to keeping glass, mirrors and radiators clean .I can use the spray on almost anything and it comes out sparkling. I have thrown out all old glass cleaners and other spray cleaners now, this Flash has replaced all of it .A wonderful find!

WesternWayDomesticGoddess • 1 year ago

Absolutely loving the results using this product. So quick and easy to use and the bathroom is gleaming !

Campergirl • 1 year ago

Flash spray wipe done bathroom is a Great product to use in my bathroom brings everything up shiny and sparkling with little effort

Candystar • 1 year ago

We all love the flash 💕 the perfect combination of the clear surface and the soft perfume is perfect

Ruth573 • 1 year ago

What an incredible scent and effective cleaning product. I had visitors at the weekend who I shared my new cleaning product with, they weee highly impressed and asked where could they buy it

Tinydancer • 1 year ago

Off to Morrisons I go! I want to try the kitchen one so this is the perfect opportunity to make content at the same time

Sarahdizzy • 1 year ago

Used flash spray wipe and done kitchen on the work tops. The fragrance is amazing!! The surfaces look shiny.
Absolutely loving the smell of the shower and bathroom cleaner sprays, they leave my bathroom not only sparkling clean but smelling super fresh too! I've handing out all my vouchers out to , neighbours, friends and family so hopefully they'll be equally impressed!

pompeytjay • 1 year ago

When I received my flash products I couldn’t wait to try them out, I must say they were amazing and it left my rooms smelling fresh and clean, this is a product that I can see myself buying in the shops with the amazing results it has left. Thank you for allowing me to take part in this.

Holly9588 • 1 year ago

Will try to create a Easter egg style hunt for the flash sprays!

TayTay • 1 year ago

Ahh the smell is lovely! Often find the scent of these things sickly, but this didn't even vaguely make me feel yuck. Cleans nicely and easily, leaves a nice fresh smell on surfaces. Great!

Petsare4me • 1 year ago

Absolutely brilliant will carry on with it 👌

Andrea14 • 1 year ago

Really over the moon to receive this parcel to try out. I particularly love the shower one as it makes cleaning glass and mirrors so much easier . Definitely go and buy one to give it a try and you won’t be disappointed

Lah52 • 1 year ago

Cleaned my kitchen sink and draining board earlier with the kitchen spray. What a glorious fragrance! Surfaces gleaming. Really impressed.

psalmody • 1 year ago

Using the kitchen spray I was impressed and loved the fresh smell. Using the bathroom spray I found made easy work of our ensuite and left it smelling really fresh and lovely.

CLAIREHIN • 1 year ago

Shower screen looks fantastic and some happy friends & family with the discount vouchers!

iskia • 1 year ago

I never beforre used Flash cleanig products but now I love them.I love the smell and how easy is to wipe and clean it.My bathrooms is little nore shiny now and kitchen looks newer.

aggyg • 1 year ago

Great quality spray, no drips or issues with application. A nice generous size bottle that will last many applications. The bathroom cleaner was a pleasure to use. The smell filled the room and lasted until the next clean. Very effective the sink and taps sparkled. Very pleased with this product.

Torie1206 • 1 year ago

Love the smell it’s amazing and leaves bathroom sparkling

Pamv • 1 year ago

Loving the Flash bathroom spray and shower spray so much . Went into Morrisons and saw the kitchen spray and bought that also for my collection.
#spraywipecleanshinesmelldevine

Ifari • 1 year ago

Flash spray smells amazing, so you immediately fall in love with it. 🥰😍🤩
Each time I use, I'm not disappointed just surprised how good it is. 👍💯🔥
Love it!!! ❤️❤️❤️

Aroseythorn • 1 year ago

Absolutely blown away by how good this is both the kitchen and bathroom sprays are fantastic. My house never smelt so good

titchthepunkess • 1 year ago

Been using these a few weeks now, love the smell of them both, love the bathroom one it works really well, it does leave a few steaks on my shower glass but they all seem to, love the clean fresh smell once I've finished. The kitchen one is amazing again the smell once I've used it lovely, cleans with ease leaves my worktop lovely, knowing there clean with a small child about is satisfying as they just put everything down regardless of the state of the item it's quick and easy to use and great at removing stubborn dried splotches!

Alysuk • 1 year ago

Really impressed with Flash bathroom...when my toddler do a lot of mess here cames Flash to help me...easy to use and remove limescale better than other spray.Very happy with this

Kirsty35 • 1 year ago

Wow the results are amazing my bathroom is gleaming and smells amazing 😍

maxwellpam • 1 year ago

The Flash Spray Wipe Done have made my worktops so shiny and bright!!

kristyhay • 1 year ago

These smell amazing and clean really well, impressed so far, have used the kitchen spray will be using the bathroom one later today.

wimbledon • 1 year ago

Used both for weekly cleaning and very effective compared to previous supermarket brand and the shower spray would have been an ideal triple so will use a voucher to buy this .

Moo78 • 1 year ago

Wonderful products which I have used in my Airbnb and will buy again in the future !
Moo78

Welshkazza • 1 year ago

Spring is finally here and you know what that means, time to get my spring cleaning head on. Kitchen cleaned, bathroom cleaned. Both now grime free, smelling fresh and sparkling. Am very impressed with the Flash cleaners, have spread the word sharing the coupons with my friends and family.

Juda • 1 year ago

Amazing results once again using Flash Spray Wipe Done Shower on my glass screen. It's so clean and shiny it's too difficult to get photographic evidence.

Shy786One • 1 year ago

Have used the kitchen flash it’s smells amazing my cooker top is shiny plus sink work tops. Used the bathroom flash the bath has such a sparkle to it and my upstairs sinks are glowing. They only take a few sprays yet so much still in the bottles . Just great

Bubblegum26 • 1 year ago

Loving both my products, I am really surprised at how easy it was to get a really good deep clean and shine ..... I cleaned just before my friends came over the other day and they all commented how nice the smell was and how shiny my kitchen looked ... they loved leaving with a voucher ..Thank you for giving me the chance to try these products

SuziS • 1 year ago

Such a great product - so quick and easy to use! Makes cleaning difficult areas (kitchen and bathroom) effortless :)

Minerva • 1 year ago

My bathroom has never looked so sparkling and clean! So quick and easy. No water marks or smears. Honestly it was so quick to clean and I just love the smell of the sprays.

Dortty • 1 year ago

This wipe down spray it fabulous in the bathroom just spray and wipe! No rince but so much shine ! In the shower spray allover leave a while and wash down fabulous shine and it stays shining what more can you need !!

shaz78 • 1 year ago

My favourite has to be the kitchen spray . I love the scent and how my surfaces look after I have cleaned them.

Ebmum • 1 year ago

Wow - so impressed with Flash Spray, Wipe, Done Bathroom. Cleaned the sink and bath in only 3 minutes while I waited for my hair conditioner to absorb. Multi tasking at its best 😁 Loving my shiny taps!

mumma68 • 1 year ago

These flash products are amazing. The Flash shower product really cleaned water marks and removed dirt, with a lovely fresh fragrance that was not harsh when using.
The Flash bathroom cleaned through lime scale and left a sparkling shine on the taps.

sartemisa • 1 year ago

Being away from home for a few hours, getting caught up with things and coming back in that nice smell brings back memories all of a sudden ;) Magic

Glorip • 1 year ago

I'm loving the bathroom spray. It's very quick to use with excellent results, and it smells nice. The shower spray made cleaning our showers easy.

Woodsyp • 1 year ago

Have the bathroom and kitchen spray but particularly love the kitchen spray. I have a very busy kitchen and spray wipe done is a revelation. It’s so easy to clean down my kitchen at the end of the day and the smell leaves my kitchen and bathroom smelling amazing

JamesE • 1 year ago

Enjoying using these Flash products, they have a lovely scent and easily clears dirt and grime. The one thing I have noted however is the bathroom one struggles with clearing limescale.

supersaveme • 1 year ago

Brilliant ! The difference with the bathroom cleaner was immediately noticed and is a fantastic product.
The kitchen cleaner left all surfaces , etc gleaming and almost new!

And.... so easy to use, no exertion and very convenient.

dhami • 1 year ago

I was so amazed with the Bathroom flash, it made my cleaning so easy and enjoyable. the fragrance was absolutely amazing and long lasting.

poppykins • 1 year ago

SOOOO happy with his product! I have cleaned the bathroom and shower and both products I am really happy with.
The products do a great job of getting surfaces cleaned easily but have a great scent too.
Friends family and colleagues very happy with the products too after I gave out the vouchers.
Definitely recommend these products, I now need to try the kitchen product.

Curtains1 • 1 year ago

These smell amazing, I cleaned my bathroom and left the window open, after about 1 hour I went back in and the room still smelt so fresh and my bath and sink looked shiny and was brought back to life. The bottles are huge and go along way. The price tag is so cheap for the amount of product you receive, if you haven't already you need to purchase

YourElf.com • 1 year ago

Thank you so much for the product! It’s truly great and works wonders. I’m really impressed with its quality and effectiveness. Appreciate the opportunity to try it!

Scottie1979 • 1 year ago

Happy with these sprays. Clean well and smell great

morello • 1 year ago

I am loving trying out these Flash Spray Wipe Done Bathroom and Shower cleaners. The smell gorgeous and leave my surfaces fresh and streak free. What more can you ask for. Cleaning has never been so easy and that can only be a good thing. Having shared out the money off coupons my firnds and family are getting a bargain.

l00byl00 • 1 year ago

So happy with these Flash sprays. They do the job really quickly and well, so that the difference before and after is amazing. I am trying to find out if they are anti-bacterial too, and think they are, but can P&G confirm it please?
Either way, the clean is good which has to be a start.

CWarrilow93 • 1 year ago

I am loving these flash sprays dont need alot either 😀 and the smells are so fresh and clean will be taking more pictures tomorrow of me using it and posting on socials.

JacStn • 1 year ago

I've thoroughly enjoyed using the Flash products, my bathroom and shower are gleaming and smell glorious. I'm purchased the Kitchen one myself and love that too! without getting the opportunity to try these products, I would probably have missed them, so thank you to supersavvyme for giving me the opportunity 😊

Testerlady • 1 year ago

Loving the smell of the new sprays! Makes the kitchen and bathroom smell fresh and welcoming as well as making a good job of cleaning the surfaces.

Rachael.Elizabethx • 1 year ago

I love both sprays I got the Flash kitchen spray and Flash bathroom spray they both smells so nice and so easy to use, gets the cleaning done quicker

Marionjay • 1 year ago

Love the new Flash, especially the Kitchen shine, does as it says, just spray, wipe, done, clean and sparking surfaces, easy to use, win win, saves me time and effort.

Veacoker • 1 year ago

I am really delighted with the new Flash products "Spray Wipe Done".
I have been responsible for cleaning my house for over 60 years so I know a thing or two about cleaning products and normally new products promise a lot but deliver little, so when I received samples, I did not have high expectations.
I am however happy to say that on this occasion, the result exceeded my expectations as for once they actually worked - leaving surfaces gleaming with very little effort.
Thank you Flash - I will buy these again

Ladontie • 1 year ago

Absolutely love the spray wipe done kitchen spray smells absolutely amazing by far the best smelling products and love that I don't need to rinse of after use no residue or anything left behind and the bathroom spray leaves tiles shiny and they actually feel clean will definitely be buying from now in.

jackiect • 1 year ago

I've been using these bathroom products for a while now and have mixed reviews. The shower screens came up great and don't need cleaning every day as I had to do previously which is brilliant. The scum on the tiles in the shower came off easily and look lovely as do the shower hose, taps etc but the grout (which is not that old) does not want to come clean nor does the mark on the shower tray where we stand. I prefer the smell of the bathroom spray to the shower one and was a little confused that I could use both for some parts... Overall I do think it's an improvement on the standard Flash that I normally use and am suggesting to my friends to try it.

Rahmina • 1 year ago

Absolutely loving Flash Spray Wipe Done! My house smells beautiful and looks clean as ever! Only downside is there are no morrisons in Northen Island!!

Shaznav • 1 year ago

Tried the kitchen spray on a dried muddy footprint on my lino, brilliant, came off so easily. Sparkling worktops and induction hob to boot. Thank you flash for making this so easy.

Ailsasheldon • 1 year ago

I’ve made my first TikTok videos for this campaign. And my kids didn’t help me! Hope they are ok

53rovers • 1 year ago

all vouchers were given out and all our friends are happy with the way FLASH has worked. Big thumbs up

Candystar • 1 year ago

Family and friends are all pleased with the vouchers I gave out they have been able to get at the super as at the moment flash spray wipe is on offer so using the vouchers makes it much more affordable and easy on the pocket
Not to mention how much you can use it on not only the bathroom Iam all over the house 🏡 with it
Thanks for keeping me updated with this latest product and love sharing out the vouchers

Shirley.Rose • 1 year ago

My family, work colleagues and friends have loved using the vouchers. They have all purchased a range of the flash products with their coupons and are incredibly enthusiastic about the excellent results. We all shared the same opinion concerning the excellent results with little or no effort and love the fresh clean smell it leaves behind.

Maggit • 1 year ago

These are amazing, it's definitely spray, wipe, done, they work great, easy to use, the orange citrus one has an very fresh aroma, I'm not a fan of the scent of the blue one but that doesn't stop it doing a brilliant job.

thiglett • 1 year ago

Flash was fab in my home kitchen & bathroom BUT on the Airbnb clean @hilltopoasis it made the job 1000 times easier than my normal product, leaving the cabin fresh and sparkling.

Laus • 1 year ago

Both my kitchen and bathroom are so sparkly clean, so pleased with both of the sprays

Sahrah94 • 1 year ago

Works like wonders

Freebiee • 1 year ago

I wish we had a Morrisons where I live :(

SassyC • 1 year ago

Amazing and so quick to use! Smells great too.

Timeakinga • 1 year ago

Loving the smell, it lasts all day in the bathroom and kitchen. I would definitely recommend this to my friend and my family members .

Posy • 1 year ago

Flash you've come up trumps. Can't believe how easy to use and with such quick brilliant results. The shower spray and bathroom are both superb, spray, wipe and the shine appears and leaves you ensuite and bathroom smelling fresh. Would I buy again definitely and spreading the word definite.

Nikol • 1 year ago

I will definitely buy some more by using my vouchers! The smell of the bathroom spray is so nice and long lasting.

FlowerC • 1 year ago

Smells great and makes everything sparkle

redone • 1 year ago

Love the flash sprays been doing a brilliant job in my bathroom everything looks and smells brilliant definitely recommends these to anyone

becky818 • 1 year ago

Can’t get enough of the flash spray wipe done KITCHEN the smell is just absolutely divine 🥰 every morning I make it a regular to wipe my kitchen sides leave the kitchen smelling fresh all day ❤️… the bathroom cleaner also smells great but I do prefer to use a different product but still a great product makes cleaning so much more easier.

801Man • 1 year ago

Just finished cleaning the shower…what a result with the new shower cleansing spray…the fresh clean smell is amazing

Ca • 1 year ago

Bathroom spray is my favourite of the two, like the smell, good powerful spray trigger

Ca • 1 year ago

Shower spray unfortunately smells too strong, my sister has is slightly sensitiveity due to health issues and can't cope with it

Ca • 1 year ago

Would be good to have more instructions or tips on the bottle, the shower spray left streaks on the glass screen, I might have been using it wrong...

Ca • 1 year ago

Vouchers very welcome by all, wish they were valid a little longer

KSavvyW • 1 year ago

Just tried the flash bathroom and shower sprays on my bathroom! They were great at getting the taps shiny and water marks off the shower head! I definitely prefer the fragrance of the bathroom wipe and done than the shower but otherwise I was impressed and think these are great for a quick mid-week clean!
Can’t wait to try the kitchen spray!…with my vouchers!

Sheilamba • 1 year ago

Gotta have Spray, Wipe, Done. Ive tried the rest. This one's the best. This one's the most fun! @Morrisons @SprayWipeDone

Sheilamba • 1 year ago

Love it